Header of the page

BLASTP 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1143900466-8765-30733496847.BLASTQ4


Database: Non-redundant SwissProt sequences
           195,650 sequences; 73,396,406 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports
Query= Length=463

Distribution of 1 Blast Hits on the Query Sequence



                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|1705500|sp|P55201|BRPF1_HUMAN  Peregrin (Bromodomain and PH...  28.5    5.9    Gene info

Alignments
>gi|1705500|sp|P55201|BRPF1_HUMAN Gene info Peregrin (Bromodomain and PHD finger-containing protein 1) (BR140 protein) Length=1214 Score = 28.5 bits (62), Expect = 5.9 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 0/49 (0%) Query 322 QAVLAKYDDISLPKSATICYTAALLKARAVSDNFSDDPLSLGKGAPILS 370 ++ L +D SLP+S++ +++ + A SD S P G+G P S Sbjct 983 KSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTPSKQGRGKPSFS 1031
  Database: Non-redundant SwissProt sequences
    Posted date:  Mar 28, 2006  2:14 AM
  Number of letters in database: 7,471,329
  Number of sequences in database:  13,755
Lambda     K      H
   0.325    0.137    0.420 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13755
Number of Hits to DB: 567
Number of extensions: 21
Number of successful extensions: 0
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 0
Number of HSP's successfully gapped: 0
Length of query: 463
Length of database: 7471329
Length adjustment: 100
Effective length of query: 363
Effective length of database: 7471329
Effective search space: 2712092427
Effective search space used: 2212785927
T: 11
A: 40
X1: 15 (7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.0 bits)
S2: 61 (28.1 bits)



  
   Format   
  
   Show   Graphical OverviewLinkoutSequence RetrievalNCBI-gi in format
  
     CDS feature
  
     Masking Character Masking Color
  
   Number of:   Descriptions Alignments
  
   Alignment view   
  
   Format for PSI-BLAST   with inclusion threshold:
  
   Limit results by entrez query    or select from:
  
   Expect value range:   

Format button or Reset form button