GENSCAN 1.0 Date run: 11-Mar-105 Time: 13:11:06 Sequence 13:10:51 : 109950 bp : 32.26% C+G : Isochore 1 ( 0 - 43 C+G%) Parameter matrix: HumanIso.smat Predicted genes/exons: Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr.. ----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------ 1.03 PlyA - 992 987 6 1.05 1.02 Term - 91566 91414 153 0 0 67 49 115 0.560 2.44 1.01 Init - 106367 106323 45 2 0 78 73 63 0.572 4.53 Click here to view a PDF image of the predicted gene(s) Click here for a PostScript image of the predicted gene(s) Predicted peptide sequence(s): Predicted coding sequence(s): >13:10:51|GENSCAN_predicted_peptide_1|65_aa MSVGIEEGMSDECQILSHFSVPKCEQLLTLEFAYVMRAQRSECAGENVSVDFIRLRNAFH CRAPL >13:10:51|GENSCAN_predicted_CDS_1|198_bp atgagtgtgggtattgaagaaggtatgtcagatgaatgccagatactgtcacatttctca gtgccaaaatgtgaacaactattgaccttagagtttgcttatgtgatgagagcgcagagg tcagaatgcgctggggaaaatgtcagtgtggacttcatacgtctccggaatgcttttcac tgcagagctcctctttga