Header of the page *BLASTP 2.2.10 [Oct-19-2004]* *Reference :* Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1111085059-15551-8441328611.BLASTQ2 *Query=* FGENESH: 1 2 exon (s) 62256 - 96756 72 aa, chain + (72 letters) *Database:* All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples 2,367,365 sequences; 802,797,248 total letters If you have any problems or questions with the results of this search please refer to the *BLAST FAQs * Taxonomy reports Distribution of 20 Blast Hits on the Query Sequence ------------------------------------------------------------------------ Score E Sequences producing significant alignments: (bits) Value gi|915311|gb|AAA92289.1| Abl interactor 2 29 <#915311> 2.3 Gene info gi|32880183|gb|AAP88922.1| abl-interactor 2 [Homo sapiens] ... 29 <#32880183> 2.3 Gene info gi|7839524|gb|AAF70308.1| Abl-interactor protein 2b [Homo s... 29 <#7839524> 2.3 Gene info gi|31541785|ref|NP_005750.3| abl interactor 2 [Homo sapiens... 29 <#31541785> 2.3 Gene info gi|7512270|pir||G01936 Abl binding protein 3 - human >gi|98... 29 <#7512270> 2.3 Gene info gi|1491702|emb|CAA64980.1| argBPIB [Homo sapiens] 29 <#1491702> 2.3 Gene info gi|55959522|emb|CAI17279.1| spectrin SH3 domain binding pro... 28 <#55959522> 5.1 Gene info gi|55959518|emb|CAI17275.1| spectrin SH3 domain binding pro... 28 <#55959518> 5.1 Gene info gi|55959521|emb|CAI17278.1| spectrin SH3 domain binding pro... 28 <#55959521> 5.1 Gene info gi|55959520|emb|CAI17277.1| spectrin SH3 domain binding pro... 28 <#55959520> 5.1 Gene info gi|55959519|emb|CAI17276.1| spectrin SH3 domain binding pro... 28 <#55959519> 5.1 gi|55959517|emb|CAI17274.1| OTTHUMP00000046074 [Homo sapien... 28 <#55959517> 5.1 Gene info gi|55959516|emb|CAI17273.1| spectrin SH3 domain binding pro... 28 <#55959516> 5.1 Gene info gi|55959515|emb|CAI17272.1| spectrin SH3 domain binding pro... 28 <#55959515> 5.1 Gene info gi|23344115|gb|AAN28379.1| Abl-interactor 1 [Homo sapiens] 28 <#23344115> 5.1 Gene info gi|4885611|ref|NP_005461.1| abl-interactor 1 [Homo sapiens]... 28 <#4885611> 5.1 Gene info gi|55962146|emb|CAI16572.1| phosphoinositide-3-kinase, clas... 27 <#55962146> 8.7 Gene info gi|15451926|ref|NP_002637.2| phosphoinositide-3-kinase, cla... 27 <#15451926> 8.7 Gene info gi|7428002|pir||JC5500 phosphoinositide 3-kinase (EC 2.7.1.... 27 <#7428002> 8.7 Gene info gi|3954946|emb|CAA74194.1| PI-3 kinase [Homo sapiens] 27 <#3954946> 8.7 Gene info *Alignments* >gi|915311|gb|AAA92289.1| Gene info Abl interactor 2 Length = 401 Score = 28.9 bits (63), Expect = 2.3 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 PR YL+K++ +Y ++ + L+ G +Y ++K+ D Sbjct: 337 PRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 374 >gi|32880183|gb|AAP88922.1| Gene info abl-interactor 2 [Homo sapiens] gi|12655167|gb|AAH01439.1| Gene info Abl interactor 2 [Homo sapiens] Length = 475 Score = 28.9 bits (63), Expect = 2.3 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 PR YL+K++ +Y ++ + L+ G +Y ++K+ D Sbjct: 411 PRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 448 >gi|7839524|gb|AAF70308.1| Gene info Abl-interactor protein 2b [Homo sapiens] gi|50400673|sp|Q9NYB9|ABI2_HUMAN Gene info Abl-interactor 2 (Abelson interactor 2) (Abi-2) (Abl binding protein 3) (AblBP3) (Arg binding protein 1) (ArgBP1) Length = 513 Score = 28.9 bits (63), Expect = 2.3 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 PR YL+K++ +Y ++ + L+ G +Y ++K+ D Sbjct: 449 PRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 486 >gi|31541785|ref|NP_005750.3| Gene info abl interactor 2 [Homo sapiens] gi|1491700|emb|CAA64885.1| Gene info Arg protein tyrosine kinase-binding protein [Homo sapiens] Length = 475 Score = 28.9 bits (63), Expect = 2.3 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 PR YL+K++ +Y ++ + L+ G +Y ++K+ D Sbjct: 411 PRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 448 >gi|7512270|pir||G01936 Abl binding protein 3 - human gi|987265|gb|AAA75446.1| Gene info Abl binding protein 3 Length = 390 Score = 28.9 bits (63), Expect = 2.3 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 PR YL+K++ +Y ++ + L+ G +Y ++K+ D Sbjct: 326 PRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 363 >gi|1491702|emb|CAA64980.1| Gene info argBPIB [Homo sapiens] Length = 299 Score = 28.9 bits (63), Expect = 2.3 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 PR YL+K++ +Y ++ + L+ G +Y ++K+ D Sbjct: 235 PRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 272 >gi|55959522|emb|CAI17279.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661502|emb|CAH73117.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|4100619|gb|AAD00897.1| Gene info interactor protein AblBP4 [Homo sapiens] Length = 451 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 387 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 424 >gi|55959518|emb|CAI17275.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661497|emb|CAH73112.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|7579917|emb|CAB88006.1| Gene info spectrin SH3 binding protein [Homo sapiens] gi|50400546|sp|Q8IZP0|ABI1_HUMAN Abl-interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin SH3 domain binding protein 1) (Eps8 SH3 domain binding protein) (Eps8 binding protein) (e3B1) (Nap1 binding protein) (Nap1BP) (Abl binding protein 4) (AblBP4) Length = 508 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 444 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 481 >gi|55959521|emb|CAI17278.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661501|emb|CAH73116.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|14164310|dbj|BAB55675.1| Gene info hNap1 Binding Protein [Homo sapiens] Length = 452 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 388 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 425 >gi|55959520|emb|CAI17277.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661499|emb|CAH73114.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|2245671|gb|AAB62569.1| Gene info e3B1 [Homo sapiens] Length = 480 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 416 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 453 >gi|55959519|emb|CAI17276.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661498|emb|CAH73113.1| spectrin SH3 domain binding protein 1 [Homo sapiens] Length = 481 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 417 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 454 >gi|55959517|emb|CAI17274.1| OTTHUMP00000046074 [Homo sapiens] gi|55661500|emb|CAH73115.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|18999471|gb|AAH24254.1| Gene info ABI1 protein [Homo sapiens] Length = 476 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 412 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 449 >gi|55959516|emb|CAI17273.1| Gene info spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661504|emb|CAH73119.1| Gene info spectrin SH3 domain binding protein 1 [Homo sapiens] Length = 475 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 411 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 448 >gi|55959515|emb|CAI17272.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|55661503|emb|CAH73118.1| spectrin SH3 domain binding protein 1 [Homo sapiens] gi|7839526|gb|AAF70309.1| Gene info Abl-interactor protein 1 long [Homo sapiens] Length = 446 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 382 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 419 >gi|23344115|gb|AAN28379.1| Gene info Abl-interactor 1 [Homo sapiens] Length = 476 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 412 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 449 >gi|4885611|ref|NP_005461.1| Gene info abl-interactor 1 [Homo sapiens] gi|3165429|gb|AAC39757.1| Gene info spectrin SH3 domain binding protein 1 [Homo sapiens] Length = 508 Score = 27.7 bits (60), Expect = 5.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 7 PRIYLQKIIDLYTIQENVDHGLAASLGQQLYAVEKDHD 44 P+ Y++K++ +Y ++ D L+ G +Y ++K+ D Sbjct: 444 PKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD 481 >gi|55962146|emb|CAI16572.1| Gene info phosphoinositide-3-kinase, class 2, beta polypeptide [Homo sapiens] Length = 1634 Score = 26.9 bits (58), Expect = 8.7 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 14 IIDLYTIQENVDHGLAASLGQQLYAVEKDHDFFIAQIA--VPAADRILVFWKTSYENF 69 +++LY N D A G + + + ++ F +A V A RI + W TSYE+F Sbjct: 596 LVELYCNTFNADFQTAVP-GSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDF 652 >gi|15451926|ref|NP_002637.2| Gene info phosphoinositide-3-kinase, class 2, beta polypeptide [Homo sapiens] Length = 1634 Score = 26.9 bits (58), Expect = 8.7 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 14 IIDLYTIQENVDHGLAASLGQQLYAVEKDHDFFIAQIA--VPAADRILVFWKTSYENF 69 +++LY N D A G + + + ++ F +A V A RI + W TSYE+F Sbjct: 596 LVELYCNTFNADFQTAVP-GSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDF 652 >gi|7428002|pir||JC5500 phosphoinositide 3-kinase (EC 2.7.1.-) - human gi|13632400|sp|O00750|PK3B_HUMAN Gene info Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing beta polypeptide (Phosphoinositide 3-Kinase-C2-beta) (PtdIns-3-kinase C2 beta) (PI3K-C2beta) (C2-PI3K) gi|2076604|emb|CAA72168.1| Gene info phosphoinositide 3-kinase [Homo sapiens] Length = 1634 Score = 26.9 bits (58), Expect = 8.7 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 14 IIDLYTIQENVDHGLAASLGQQLYAVEKDHDFFIAQIA--VPAADRILVFWKTSYENF 69 +++LY N D A G + + + ++ F +A V A RI + W TSYE+F Sbjct: 596 LVELYCNTFNADFQTAVP-GSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDF 652 >gi|3954946|emb|CAA74194.1| Gene info PI-3 kinase [Homo sapiens] Length = 1609 Score = 26.9 bits (58), Expect = 8.7 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 14 IIDLYTIQENVDHGLAASLGQQLYAVEKDHDFFIAQIA--VPAADRILVFWKTSYENF 69 +++LY N D A G + + + ++ F +A V A RI + W TSYE+F Sbjct: 571 LVELYCNTFNADFQTAVP-GSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDF 627 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples Posted date: Mar 15, 2005 10:11 AM Number of letters in database: 802,797,248 Number of sequences in database: 2,367,365 Lambda K H 0.325 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,383,611 Number of Sequences: 2367365 Number of extensions: 38355 Number of successful extensions: 152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 151 Number of HSP's gapped (non-prelim): 2 length of query: 72 length of database: 46,038,991 effective HSP length: 44 effective length of query: 28 effective length of database: 40,312,787 effective search space: 1128758036 effective search space used: 1128758036 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 58 (26.9 bits) ------------------------------------------------------------------------ *Format* Show Graphical Overview Linkout Sequence Retrieval NCBI-gi in format Use new formatter Masking Character Masking Color Number of: Descriptions Alignments Alignment view Format for PSI-BLAST with inclusion threshold: Limit results by entrez query or select from: Expect value range: Format button or Reset form button