BLASTP 2.2.10 [Oct-19-2004]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1111134614-3488-197285231854.BLASTQ2 Query= ENr123|GENSCAN_gen2 69_aa (69 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples 2,367,365 sequences; 802,797,248 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1111134614-3488-197285231854.BLASTQ2
Query= ENr123|GENSCAN_gen2 69_aa (69 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples 2,367,365 sequences; 802,797,248 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|21928245|dbj|BAC05726.1| seven transmembrane helix recep... 31 0.47 gi|4502241|ref|NP_000038.1| arylsulfatase E precursor [Homo... 29 2.3 gi|58743319|ref|NP_001011719.1| arylsulfatase H [Homo sapie... 27 6.7 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|21928245|dbj|BAC05726.1| seven transmembrane helix recep... 31 0.47 gi|4502241|ref|NP_000038.1| arylsulfatase E precursor [Homo... 29 2.3 gi|58743319|ref|NP_001011719.1| arylsulfatase H [Homo sapie... 27 6.7
>gi|21928245|dbj|BAC05726.1| seven transmembrane helix receptor [Homo sapiens] Length = 1520 Score = 31.2 bits (69), Expect = 0.47 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 9 HPQGRMARGCDGSYLTDTIEIKDLPSYTSNSSKTVNLLAL 48 +PQG GC G L D IE K LP T S++ L+AL Sbjct: 1160 NPQGERCAGCAGVTLDDVIEDKPLPHGT--SAQKAKLIAL 1197
>gi|4502241|ref|NP_000038.1| arylsulfatase E precursor [Homo sapiens] gi|2118010|pir||I37187 arylsulfatase E (EC 3.1.6.-) - human gi|791004|emb|CAA58556.1| ARSE [Homo sapiens] gi|1703426|sp|P51690|ARSE_HUMAN Arylsulfatase E precursor (ASE) Length = 589 Score = 28.9 bits (63), Expect = 2.3 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Query: 23 LTDTIEIKDLPSYTSNSSKTVNLLALEDYGLKHTKHL---WLCMP 64 + D + I D+ Y +N+ +T N+ L + G+K T+H+ LC P Sbjct: 44 MADDLGIGDIGCYGNNTMRTPNIDRLAEDGVKLTQHISAASLCTP 88
>gi|58743319|ref|NP_001011719.1| arylsulfatase H [Homo sapiens] gi|58201090|gb|AAW66668.1| arylsulfatase H [Homo sapiens] Length = 562 Score = 27.3 bits (59), Expect = 6.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 23 LTDTIEIKDLPSYTSNSSKTVNLLALEDYGLKHTKHL 59 + D + + DL Y +NS T N+ L G++ T+HL Sbjct: 13 MADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHL 49
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples Posted date: Mar 15, 2005 10:11 AM Number of letters in database: 802,797,248 Number of sequences in database: 2,367,365 Lambda K H 0.319 0.132 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,466,514 Number of Sequences: 2367365 Number of extensions: 42305 Number of successful extensions: 73 Number of sequences better than 10.0: 0 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 73 Number of HSP's gapped (non-prelim): 0 length of query: 69 length of database: 46,038,991 effective HSP length: 41 effective length of query: 28 effective length of database: 40,703,210 effective search space: 1139689880 effective search space used: 1139689880 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.9 bits)
