BLASTP 2.2.8 [Jan-05-2004]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1079544606-3101-168712911218.BLASTQ3 Query= hg16_dna|GENSCAN_predicted_peptide_9|207_aa (207 letters) Database: Non-redundant SwissProt sequences 145,815 sequences; 53,526,777 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1079544606-3101-168712911218.BLASTQ3
Query= hg16_dna|GENSCAN_predicted_peptide_9|207_aa (207 letters)
Database: Non-redundant SwissProt sequences 145,815 sequences; 53,526,777 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|1175258|sp|P44011|Y523_HAEIN Hypothetical protein HI0523... 33 0.44 gi|34098561|sp|Q8G5L0|GLGB_BIFLO 1,4-alpha-glucan branching... 30 2.9 gi|34098492|sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching... 30 3.2 gi|124240|sp|P08069|IG1R_HUMAN Insulin-like growth factor I... 30 4.2 gi|2851641|sp|P46474|YHDP_ECOLI Hypothetical protein yhdP 29 8.7 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|1175258|sp|P44011|Y523_HAEIN Hypothetical protein HI0523... 33 0.44 gi|34098561|sp|Q8G5L0|GLGB_BIFLO 1,4-alpha-glucan branching... 30 2.9 gi|34098492|sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching... 30 3.2 gi|124240|sp|P08069|IG1R_HUMAN Insulin-like growth factor I... 30 4.2 gi|2851641|sp|P46474|YHDP_ECOLI Hypothetical protein yhdP 29 8.7
>gi|1175258|sp|P44011|Y523_HAEIN Hypothetical protein HI0523 precursor Length = 356 Score = 33.1 bits (74), Expect = 0.44 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 8/83 (9%) Query: 100 DTNSVFIKQPGLQEKAFDVGNFPNLPSVAAFSKPGGV------LGCS-IRSSGSTEPISL 152 D N V PG EKA+++ N N VA + K G+ L C+ + +GST P+ L Sbjct: 224 DCNVVLTAGPGESEKAYELANLVNDLRVAIYDKNKGLVDFAHSLACADLFIAGSTGPLHL 283 Query: 153 RTSM-IVNKAVLSRERSVTTKDW 174 ++ I RS + W Sbjct: 284 SSAFNIPTIGFYPNSRSSQPRRW 306
>gi|34098561|sp|Q8G5L0|GLGB_BIFLO 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 737 Score = 30.4 bits (67), Expect = 2.9 Identities = 15/52 (28%), Positives = 22/52 (42%) Query: 75 WHTDAEADWQSLANAYYQEENPGIKDTNSVFIKQPGLQEKAFDVGNFPNLPS 126 W DA DW L +++ + D N+ + P L + FD F L S Sbjct: 591 WDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPAGFQWLTS 642
>gi|34098492|sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 736 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Query: 75 WHTDAEADWQSLANAYYQEENPGIKDTNSVFIKQPGLQEK 114 W+ DAE DW L +Q + D N ++ ++P L E+ Sbjct: 590 WNHDAELDWYLLQYPEHQGVQRLVGDLNRLYREEPALHEQ 629
>gi|124240|sp|P08069|IG1R_HUMAN Insulin-like growth factor I receptor precursor (CD221 antigen) Length = 1367 Score = 29.6 bits (65), Expect = 4.2 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query: 59 IQVTTTAGSKSRVQVTWHTDAEADWQSLAN--AYYQE 93 + T+T SK+R+ +TWH D++ L + YY+E Sbjct: 493 LHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKE 529
>gi|2851641|sp|P46474|YHDP_ECOLI Hypothetical protein yhdP Length = 986 Score = 28.9 bits (63), Expect = 8.7 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 6/73 (8%) Query: 17 ETTGASGRRGCTVRCVTRLGNHVAQTSPTGFYCNNKLDLLIQIQVTTTAGSKSRVQVTWH 76 E G G R + LG+ T P+G LD+ +Q A K+R Q +W Sbjct: 65 ELAGLEGIRPLAAKLSPALGDVWRSTQPSGKINTLALDIPLQ------AADKTRFQASWS 118 Query: 77 TDAEADWQSLANA 89 A W+ L A Sbjct: 119 DLAWKQWKLLPGA 131
Database: Non-redundant SwissProt sequences Posted date: Mar 9, 2004 2:01 PM Number of letters in database: 53,526,777 Number of sequences in database: 145,815 Lambda K H 0.316 0.131 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,340,210 Number of Sequences: 145815 Number of extensions: 168804 Number of successful extensions: 292 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 292 Number of HSP's gapped (non-prelim): 1 length of query: 207 length of database: 53,526,777 effective HSP length: 105 effective length of query: 102 effective length of database: 38,216,202 effective search space: 3898052604 effective search space used: 3898052604 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 63 (28.9 bits)
