>gi|6166537|sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 precursor (Megalin) (Glycoprotein 330) (gp330) Length = 4655 Score = 30.0 bits (66), Expect = 1.00 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 26 LLNKRPQDKSAGEHPLIFENSAQHHLSGEASSDPPPTSIPRRSYPPASTDPS 77 L ++ + + E+P I+ A++ PP S+P + PP+ DP+ Sbjct: 4582 LFKRKSKQTTNFENP-IYAQMENEQKESVAATPPPSPSLPAKPKPPSRRDPT 4632
>gi|125713|sp|P00526|SRC_RSVP Tyrosine-protein kinase transforming protein SRC (p60-SRC) Length = 526 Score = 28.1 bits (61), Expect = 3.3 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Query: 30 RPQDKSAGEHPLIFENSAQHHLSGEASSDPPPTSIP------RRSYPPASTDPSLFQAF 82 +P+D S H L +S HH AS P T+ P RS+ +T+P LF F Sbjct: 7 KPKDPSQRRHSLEPPDST-HHGGFPASQTPDETAAPDAHRNPSRSFGTVATEPKLFWGF 64
>gi|20137389|sp|Q923W9|AD33_MOUSE ADAM 33 precursor (A disintegrin and metalloproteinase domain 33) Length = 797 Score = 26.6 bits (57), Expect = 9.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Query: 51 LSGEASSDPPPTSIPRRSYPPA 72 ++GE S PP TS +RS+PP+ Sbjct: 763 ITGEPSPPPPWTSCQQRSHPPS 784
Database: Non-redundant SwissProt sequences Posted date: Mar 9, 2004 2:01 PM Number of letters in database: 53,526,777 Number of sequences in database: 145,815 Lambda K H 0.314 0.129 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,512,374 Number of Sequences: 145815 Number of extensions: 91060 Number of successful extensions: 291 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 254 Number of HSP's gapped (non-prelim): 37 length of query: 84 length of database: 53,526,777 effective HSP length: 60 effective length of query: 24 effective length of database: 44,777,877 effective search space: 1074669048 effective search space used: 1074669048 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 58 (26.9 bits)