Sequence type explicitly set to Protein Sequence format is Pearson Sequence 1: gi|M86664|herpesvirus 110 aa Sequence 2: gi|1197801|dbj|BAA01508.1| 110 aa Start of Pairwise alignments Aligning... Sequences (1:2) Aligned. Score: 39 Guide tree file created: [clustalw.dnd] Start of Multiple Alignment There are 1 groups Aligning... Group 1: Sequences: 2 Score:752 Alignment Score 200 CLUSTAL-Alignment file created [clustalw.aln] CLUSTAL W (1.81) multiple sequence alignment gi|M86664|herpesvirus QTRRHLVALEQGPEPLGVWSVDAGGVSPGKEDSVILLDEKPDGAIQDVRT gi|1197801|dbj|BAA01508.1| EPGGELVALEGGPEPLRVRLVRPRGLAVGKDDRVELLQQEAQRSEEDVHA :. .***** ***** * * . *:: **:* * **:::.: : :**:: gi|M86664|herpesvirus LIWPAIGAGHAGHPGSGRFRHVGPSVRKQHPVFNSKVSQHLHADSGHVPV gi|1197801|dbj|BAA01508.1| LVGLLVGALEAGDPRLGGLGRVGARAREQHAALD---AQLLGKPQGHAGN *: :** .**.* * : :**. .*:**..:: :* * .**. gi|M86664|herpesvirus VVLGGRLRGG gi|1197801|dbj|BAA01508.1| VALEAALGGG *.* . * ** (gi|M86664|herpesvirus:0.30374,gi|1197801|dbj|BAA01508.1|:0.30374);